PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P25940_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 287aa    MW: 32395.9 Da    PI: 4.5913
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P25940_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.23.8e-2071125357
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                            k++++t+eq++ Le+ F++++++  e++ eLA+ lgL+ rqV vWFqNrRa++k+
  GSMUA_Achr8P25940_001  71 KKRRLTSEQVHLLERSFKEENKLEPERKSELAQMLGLQPRQVAVWFQNRRARWKN 125
                            56789************************************************95 PP

2HD-ZIP_I/II1309.6e-4270162193
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrl++eqv+lLE+sF+ee+kLeperK+ela+ LglqprqvavWFqnrRAR+k+kqlE+d+++Lk++ydal  ++++L k++++Lr
  GSMUA_Achr8P25940_001  70 EKKRRLTSEQVHLLERSFKEENKLEPERKSELAQMLGLQPRQVAVWFQNRRARWKNKQLERDFDQLKSSYDALLFDHDALLKDNHRLR 157
                            69************************************************************************************** PP

            HD-ZIP_I/II  89 eelke 93 
                            ++l++
  GSMUA_Achr8P25940_001 158 SQLST 162
                            *9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.99E-2062128IPR009057Homeodomain-like
PROSITE profilePS5007118.15566126IPR001356Homeobox domain
SMARTSM003893.6E-2069130IPR001356Homeobox domain
CDDcd000864.10E-1971127No hitNo description
PfamPF000461.8E-1771125IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.6E-2172133IPR009057Homeodomain-like
PRINTSPR000312.8E-697106IPR000047Helix-turn-helix motif
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PRINTSPR000312.8E-6106122IPR000047Helix-turn-helix motif
PfamPF021831.9E-15126167IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MDSGRLIFDS ASSSSSRGPL LLWGGGNPVL RAVSPVVVGV AEKGGASKRR PFFTSPDEVY  60
EEYYEEQLPE KKRRLTSEQV HLLERSFKEE NKLEPERKSE LAQMLGLQPR QVAVWFQNRR  120
ARWKNKQLER DFDQLKSSYD ALLFDHDALL KDNHRLRSQL STLAEKLEEA NEQGASGVTV  180
LTVDDQAAST ADLTVLNIQQ KKVEDMLSPG SGGSAVVEAE GGHHLVESSR ESYLPENYHC  240
VELVDVVGIH SEDDMSDEGC SYYPDGMFTE HHQQEEVEAQ LDWCIWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118126RRARWKNKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009415373.10.0PREDICTED: homeobox-leucine zipper protein HOX16-like
SwissprotQ6YWR44e-74HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16
TrEMBLM0TTP70.0M0TTP7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P25940_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.18e-61homeobox 1